Web stats for Newarkdelawarecriminaldefenselawyer - newarkdelawarecriminaldefenselawyer.com
1.67 Rating by ClearWebStats
newarkdelawarecriminaldefenselawyer.com is 7 years 2 months 1 week old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, newarkdelawarecriminaldefenselawyer.com is SAFE to browse.
Traffic Report of Newarkdelawarecriminaldefenselawyer
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
91
Siteadvisor Rating
Not Applicable
Where is newarkdelawarecriminaldefenselawyer.com server located?
Hosted IP Address:
92.48.78.51
Hosted Country:
GB
Location Latitude:
51.5228Location Longitude:
-0.71986Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 92.48.78.51)
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Aug 2017 16:05:01 GMT
Server: Apache
Last-Modified: Fri, 09 Jun 2017 09:45:42 GMT
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3123
Content-Type: text/html
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Aug 2017 16:05:01 GMT
Server: Apache
Last-Modified: Fri, 09 Jun 2017 09:45:42 GMT
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3123
Content-Type: text/html
Domain Information for newarkdelawarecriminaldefenselawyer.com
| Domain Registrar: |
GMO INTERNET, INC. DBA ONAMAE.COM
|
|---|---|
| Registration Date: | 2017-02-22 7 years 2 months 1 week ago |
| Last Modified: | 2017-05-31 6 years 11 months 17 hours ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.seafooddomains.com |
|
213.229.101.106 |
United Kingdom
|
| ns2.seafooddomains.com |
|
213.229.101.106 |
United Kingdom
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| newarkdelawarecriminaldefenselawyer.com | A | 14400 |
IP:92.48.78.51 |
| newarkdelawarecriminaldefenselawyer.com | NS | 86400 |
Target:ns1.ndx21.com |
| newarkdelawarecriminaldefenselawyer.com | NS | 86400 |
Target:ns2.ndx21.com |
| newarkdelawarecriminaldefenselawyer.com | SOA | 86400 |
MNAME:ns1.ndx21.com RNAME:rt.nocmonitoring.org Serial:2017053102 Refresh:3600 Retry:7200 Expire:1209600 |
| newarkdelawarecriminaldefenselawyer.com | MX | 14400 |
Target:newarkdelawarecriminaldefenselawyer.com |
Similarly Ranked Websites to Newarkdelawarecriminaldefenselawyer
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
1 
$ 8,833,062,960.00
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
1 $ 8,833,062,960.00
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
1 $ 8,833,062,960.00
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
1 $ 8,833,062,960.00
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
1 $ 8,833,062,960.00
Full WHOIS Lookup for newarkdelawarecriminaldefenselawyer.com
Domain Name: NEWARKDELAWARECRIMINALDEFENSELAWYER.COM
Registry Domain ID: 2099622370_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.discount-domain.com
Registrar URL: http://www.onamae.com/
Updated Date: 2017-05-31T07:12:38Z
Creation Date: 2017-02-22T08:00:05Z
Registry Expiry Date: 2018-02-22T08:00:05Z
Registrar: GMO Internet, Inc. dba Onamae.com
Registrar IANA ID: 49
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +81.337709199
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.SEAFOODDOMAINS.COM
Name Server: NS2.SEAFOODDOMAINS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-08T16:04:45Z
Registry Domain ID: 2099622370_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.discount-domain.com
Registrar URL: http://www.onamae.com/
Updated Date: 2017-05-31T07:12:38Z
Creation Date: 2017-02-22T08:00:05Z
Registry Expiry Date: 2018-02-22T08:00:05Z
Registrar: GMO Internet, Inc. dba Onamae.com
Registrar IANA ID: 49
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +81.337709199
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.SEAFOODDOMAINS.COM
Name Server: NS2.SEAFOODDOMAINS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-08T16:04:45Z